SCOPe 2.08: Domain d3zxwg1: 3zxw G:12-150

Lineage for d3zxwg1 (3zxw G:12-150)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families)
   C-terminal domain is beta/alpha barrel

5. Family d.58.9.0: automated matches [227234] (1 protein)
   not a true family

6. Protein automated matches [226983] (27 species)
   not a true protein

7. Species Thermosynechococcus elongatus [TaxId:197221] [226343] (2 PDB entries)

8. Domain d3zxwg1: 3zxw G:12-150 [201388]
   Other proteins in same PDB: d3zxwa2, d3zxwb_, d3zxwc2, d3zxwd_, d3zxwe2, d3zxwf_, d3zxwg2, d3zxwh_
   automated match to d1wdda2
   complexed with cap, gol, mg

Details for d3zxwg1

PDB Entry: 3zxw, 2.1 Å

PDB Description: structure of activated rubisco from thermosynechococcus elongatus complexed with 2-carboxyarabinitol-1,5-diphosphate

PDB Compounds: (G:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d3zxwg1:

Sequence; same for both SEQRES and ATOM records:

>d3zxwg1 d.58.9.0 (G:12-150) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
gyqagvkdyrltyytpdytpkdtdilaafrvtpqpgvpfeeaaaavaaesstgtwttvwt
dlltdldrykgccydieplpgednqfiayiaypldlfeegsvtnmltsivgnvfgfkalk
alrledlripvaylktfqg

Timeline for d3zxwg1:

• d3zxwg1 first appeared in SCOPe 2.03
  
• d3zxwg1 appears in SCOPe 2.07