![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) ![]() automatically mapped to Pfam PF00016 |
![]() | Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins) N-terminal domain is alpha+beta |
![]() | Protein automated matches [226984] (16 species) not a true protein |
![]() | Species Thermosynechococcus elongatus [TaxId:197221] [226344] (2 PDB entries) |
![]() | Domain d3zxwc2: 3zxw C:151-475 [201384] Other proteins in same PDB: d3zxwa1, d3zxwb_, d3zxwc1, d3zxwd_, d3zxwe1, d3zxwf_, d3zxwg1, d3zxwh_ automated match to d1wdda1 complexed with cap, gol, mg |
PDB Entry: 3zxw (more details), 2.1 Å
SCOPe Domain Sequences for d3zxwc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zxwc2 c.1.14.1 (C:151-475) automated matches {Thermosynechococcus elongatus [TaxId: 197221]} pphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldftkddeninsqp fqrwrdrflfvadaihkaqaetgeikghylnvtaptceemlkraefakelempiimhdfl tagftanttlskwcrdngmllhihramhavmdrqknhgihfrvlakclrmsggdhihtgt vvgklegdkavtlgfvdllrenyieqdrsrgiyftqdwasmpgvmavasggihvwhmpal vdifgddavlqfgggtlghpwgnapgatanrvaleaciqarnegrdlmreggdiireaar wspelaaacelwkeikfefeaqdti
Timeline for d3zxwc2: