Lineage for d3zxwa1 (3zxw A:12-150)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2952777Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 2952998Family d.58.9.0: automated matches [227234] (1 protein)
    not a true family
  6. 2952999Protein automated matches [226983] (27 species)
    not a true protein
  7. 2953305Species Thermosynechococcus elongatus [TaxId:197221] [226343] (2 PDB entries)
  8. 2953314Domain d3zxwa1: 3zxw A:12-150 [201380]
    Other proteins in same PDB: d3zxwa2, d3zxwb_, d3zxwc2, d3zxwd_, d3zxwe2, d3zxwf_, d3zxwg2, d3zxwh_
    automated match to d1wdda2
    complexed with cap, gol, mg

Details for d3zxwa1

PDB Entry: 3zxw (more details), 2.1 Å

PDB Description: structure of activated rubisco from thermosynechococcus elongatus complexed with 2-carboxyarabinitol-1,5-diphosphate
PDB Compounds: (A:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d3zxwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zxwa1 d.58.9.0 (A:12-150) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
gyqagvkdyrltyytpdytpkdtdilaafrvtpqpgvpfeeaaaavaaesstgtwttvwt
dlltdldrykgccydieplpgednqfiayiaypldlfeegsvtnmltsivgnvfgfkalk
alrledlripvaylktfqg

SCOPe Domain Coordinates for d3zxwa1:

Click to download the PDB-style file with coordinates for d3zxwa1.
(The format of our PDB-style files is described here.)

Timeline for d3zxwa1: