SCOPe 2.06: Domain d3zumh2: 3zum H:36-245

Lineage for d3zumh2 (3zum H:36-245)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.41: PRC-barrel domain [50345] (1 superfamily)
   core: barrel, partly opened; n*=5, S*=8; meander

4. Superfamily b.41.1: PRC-barrel domain [50346] (5 families)

5. Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins)

6. Protein Photosynthetic reaction centre [50348] (4 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [50350] (84 PDB entries)
   Uniprot P11846

8. Domain d3zumh2: 3zum H:36-245 [201370]
   Other proteins in same PDB: d3zumh1, d3zuml_, d3zumm_
   automated match to d1qovh1
   complexed with bcl, bph, fe, lda, po4, spn, u10; mutant

Details for d3zumh2

PDB Entry: 3zum, 2.5 Å

PDB Description: photosynthetic reaction centre mutant with phe l146 replaced with ala

PDB Compounds: (H:) reaction center protein h chain

SCOPe Domain Sequences for d3zumh2:

Sequence; same for both SEQRES and ATOM records:

>d3zumh2 b.41.1.1 (H:36-245) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaa

Timeline for d3zumh2:

• d3zumh2 first appeared in SCOPe 2.03
  
• d3zumh2 appears in SCOPe 2.05
  
• d3zumh2 appears in SCOPe 2.07
  
• d3zumh2 appears in the current release, SCOPe 2.08