Lineage for d1qkzh1 (1qkz H:1-113)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 287097Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
  6. 287195Protein Immunoglobulin heavy chain variable domain, VH [88543] (19 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogeneous CDRs are listed as engineered species
  7. 287316Species Mouse (Mus musculus), cluster 2.2 [TaxId:10090] [88550] (47 PDB entries)
  8. 287322Domain d1qkzh1: 1qkz H:1-113 [20137]
    Other proteins in same PDB: d1qkza_, d1qkzh2, d1qkzl1, d1qkzl2
    part of Fab MN14C11.6

Details for d1qkzh1

PDB Entry: 1qkz (more details), 1.95 Å

PDB Description: fab fragment (mn14c11.6) in complex with a peptide antigen derived from neisseria meningitidis p1.7 serosubtype antigen and domain ii from streptococcal protein g
PDB Compounds: (H:)

SCOP Domain Sequences for d1qkzh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qkzh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2}
dvklvesggglvkpgrslklscaasgftfsdyymfwvrqtpeqrlewvatisdggaytyy
pdsvkgrftisrdnaknnlylqmnslksedtgmyycardpleyygmdywgqgtsvavss

SCOP Domain Coordinates for d1qkzh1:

Click to download the PDB-style file with coordinates for d1qkzh1.
(The format of our PDB-style files is described here.)

Timeline for d1qkzh1: