SCOPe 2.05: Domain d3zqka_: 3zqk A:

Lineage for d3zqka_ (3zqk A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.62: vWA-like [53299] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.62.1: vWA-like [53300] (6 families)

5. Family c.62.1.0: automated matches [191586] (1 protein)
   not a true family

6. Protein automated matches [191045] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188880] (10 PDB entries)

8. Domain d3zqka_: 3zqk A: [201365]
   automated match to d3zqkb_
   complexed with ca, gol, nag

Details for d3zqka_

PDB Entry: 3zqk, 1.7 Å

PDB Description: von willebrand factor a2 domain with calcium

PDB Compounds: (A:) von willebrand factor

SCOPe Domain Sequences for d3zqka_:

Sequence; same for both SEQRES and ATOM records:

>d3zqka_ c.62.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smvldvafvlegsdkigeadfnrskefmeeviqrmdvgqdsihvtvlqysymvtveypfs
eaqskgdilqrlreiryqggnrtntglalrylsdhsflvsqgdreqapnlvymvtgnpas
deikrlpgdiqvvpigvgpnanvqelerigwpnapiliqdfetlpreapdlvlqrccsge
g

Timeline for d3zqka_:

• d3zqka_ first appeared in SCOPe 2.03
  
• d3zqka_ appears in SCOPe 2.04
  
• d3zqka_ appears in SCOPe 2.06
  
• d3zqka_ appears in the current release, SCOPe 2.08