Lineage for d3zo7f_ (3zo7 F:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2556580Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2557030Family d.58.4.0: automated matches [191316] (1 protein)
    not a true family
  6. 2557031Protein automated matches [190081] (31 species)
    not a true protein
  7. 2557299Species Rhodococcus opacus [TaxId:37919] [196895] (4 PDB entries)
  8. 2557349Domain d3zo7f_: 3zo7 F: [201360]
    automated match to d3zo7a_
    complexed with cl, k6h

Details for d3zo7f_

PDB Entry: 3zo7 (more details), 2.22 Å

PDB Description: Crystal structure of ClcFE27A with substrate
PDB Compounds: (F:) 5-chloromuconolactone dehalogenase

SCOPe Domain Sequences for d3zo7f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zo7f_ d.58.4.0 (F:) automated matches {Rhodococcus opacus [TaxId: 37919]}
mlylvrmtvnlprnldpreeerlkasakarsrtlqeqgqwrylwrttgkygnisvfdvns
hdelheilwslpffpyltidveplshhparv

SCOPe Domain Coordinates for d3zo7f_:

Click to download the PDB-style file with coordinates for d3zo7f_.
(The format of our PDB-style files is described here.)

Timeline for d3zo7f_: