Lineage for d1qkzl1 (1qkz L:1-107)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2740696Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2740916Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (132 PDB entries)
    Uniprot P01631 #KV2G_MOUSE Ig kappa chain V-II region 26-10; 79% sequence identity ! Uniprot P06310 # KV2F_HUMAN IG KAPPA CHAIN V-II REGION RPMI 6410 PRECURSOR ! Uniprot P03976 # KV2E_MOUSE (P03976) Ig kappa chain V-II region 17S29.1 ! Uniprot P01642 21-115 # ! KV2G_MOUSE IG KAPPA CHAIN V-II REGION 26-10
  8. 2740950Domain d1qkzl1: 1qkz L:1-107 [20136]
    Other proteins in same PDB: d1qkza_, d1qkzh1, d1qkzh2, d1qkzl2
    part of Fab MN14C11.6

Details for d1qkzl1

PDB Entry: 1qkz (more details), 1.95 Å

PDB Description: fab fragment (mn14c11.6) in complex with a peptide antigen derived from neisseria meningitidis p1.7 serosubtype antigen and domain ii from streptococcal protein g
PDB Compounds: (L:) antibody

SCOPe Domain Sequences for d1qkzl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qkzl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]}
nivmtqtplslpvslgdqasiscrssqslvhsngntylhwylqkpgqspklliytvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthfptfgggtkleik

SCOPe Domain Coordinates for d1qkzl1:

Click to download the PDB-style file with coordinates for d1qkzl1.
(The format of our PDB-style files is described here.)

Timeline for d1qkzl1: