Lineage for d3zo7d_ (3zo7 D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949708Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2950158Family d.58.4.0: automated matches [191316] (1 protein)
    not a true family
  6. 2950159Protein automated matches [190081] (33 species)
    not a true protein
  7. 2950427Species Rhodococcus opacus [TaxId:37919] [196895] (4 PDB entries)
  8. 2950475Domain d3zo7d_: 3zo7 D: [201358]
    automated match to d3zo7a_
    complexed with cl, k6h

Details for d3zo7d_

PDB Entry: 3zo7 (more details), 2.22 Å

PDB Description: Crystal structure of ClcFE27A with substrate
PDB Compounds: (D:) 5-chloromuconolactone dehalogenase

SCOPe Domain Sequences for d3zo7d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zo7d_ d.58.4.0 (D:) automated matches {Rhodococcus opacus [TaxId: 37919]}
mlylvrmtvnlprnldpreeerlkasakarsrtlqeqgqwrylwrttgkygnisvfdvns
hdelheilwslpffpyltidveplshhparv

SCOPe Domain Coordinates for d3zo7d_:

Click to download the PDB-style file with coordinates for d3zo7d_.
(The format of our PDB-style files is described here.)

Timeline for d3zo7d_: