Lineage for d3znuj_ (3znu J:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2193227Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2193599Family d.58.4.0: automated matches [191316] (1 protein)
    not a true family
  6. 2193600Protein automated matches [190081] (27 species)
    not a true protein
  7. 2193819Species Rhodococcus opacus [TaxId:37919] [196895] (4 PDB entries)
  8. 2193829Domain d3znuj_: 3znu J: [201353]
    automated match to d3znua_
    complexed with cl, edo, mg

Details for d3znuj_

PDB Entry: 3znu (more details), 1.65 Å

PDB Description: Crystal structure of ClcF in crystal form 2
PDB Compounds: (J:) 5-chloromuconolactone dehalogenase

SCOPe Domain Sequences for d3znuj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3znuj_ d.58.4.0 (J:) automated matches {Rhodococcus opacus [TaxId: 37919]}
mlylvrmtvnlprnldpreeerlkasekarsrtlqeqgqwrylwrttgkygnisvfdvns
hdelheilwslpffpyltidveplshhparv

SCOPe Domain Coordinates for d3znuj_:

Click to download the PDB-style file with coordinates for d3znuj_.
(The format of our PDB-style files is described here.)

Timeline for d3znuj_: