| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) ![]() dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
| Family d.58.4.0: automated matches [191316] (1 protein) not a true family |
| Protein automated matches [190081] (33 species) not a true protein |
| Species Rhodococcus opacus [TaxId:37919] [196895] (4 PDB entries) |
| Domain d3znui_: 3znu I: [201352] automated match to d3znua_ complexed with cl, edo, mg |
PDB Entry: 3znu (more details), 1.65 Å
SCOPe Domain Sequences for d3znui_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3znui_ d.58.4.0 (I:) automated matches {Rhodococcus opacus [TaxId: 37919]}
mlylvrmtvnlprnldpreeerlkasekarsrtlqeqgqwrylwrttgkygnisvfdvns
hdelheilwslpffpyltidveplshhparv
Timeline for d3znui_: