Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species) |
Species Bactericidal Fab MN12H2, (mouse), kappa L chain [48874] (3 PDB entries) against Neisseria meningitidis |
Domain d1mpah1: 1mpa H:1-121 [20135] Other proteins in same PDB: d1mpah2, d1mpal2 complexed with cd, cyf, thc |
PDB Entry: 1mpa (more details), 2.6 Å
SCOP Domain Sequences for d1mpah1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mpah1 b.1.1.1 (H:1-121) Immunoglobulin (variable domains of L and H chains) {Bactericidal Fab MN12H2, (mouse), kappa L chain} evnlqqsgtvlarpgasvrmsckasgysftsywlhwikqrpgqglewiggiypgnrdtry tqrfkdkakltavtsantaymelssltnedsavyycsiiyfdyadfimdywgqgttvtvs s
Timeline for d1mpah1: