SCOPe 2.03: Domain d3zlqd_: 3zlq D:

Lineage for d3zlqd_ (3zlq D:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (16 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (60 PDB entries)

8. Domain d3zlqd_: 3zlq D: [201342]
   Other proteins in same PDB: d3zlqa_, d3zlqb_
   automated match to d3ezjb_
   complexed with 6t9

Details for d3zlqd_

PDB Entry: 3zlq, 2.1 Å

PDB Description: bace2 xaperone complex

PDB Compounds: (D:) xa4813

SCOPe Domain Sequences for d3zlqd_:

Sequence; same for both SEQRES and ATOM records:

>d3zlqd_ b.1.1.1 (D:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlqesggglvqpggslrlscaasgftfssaimtwvrqapgkgrewvstigsdgsitty
adsvkgrftisrdnarntlylqmnslkpedtavyyctsagrrgpgtqvtvss

Timeline for d3zlqd_:

• d3zlqd_ is new in SCOPe 2.03-stable
  
• d3zlqd_ appears in SCOPe 2.04
  
• d3zlqd_ appears in the current release, SCOPe 2.08, called d3zlqd1