Lineage for d3zlqc1 (3zlq C:165-271)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2347168Protein automated matches [190119] (20 species)
    not a true protein
  7. 2347651Species Llama (Lama glama) [TaxId:9844] [187485] (155 PDB entries)
  8. 2347748Domain d3zlqc1: 3zlq C:165-271 [201341]
    Other proteins in same PDB: d3zlqa_, d3zlqb_, d3zlqc2, d3zlqd2
    automated match to d3ezjb_
    complexed with 6t9

Details for d3zlqc1

PDB Entry: 3zlq (more details), 2.1 Å

PDB Description: bace2 xaperone complex
PDB Compounds: (C:) xa4813

SCOPe Domain Sequences for d3zlqc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zlqc1 b.1.1.1 (C:165-271) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvqpggslrlscaasgftfssaimtwvrqapgkgrewvstigsdgsittyadsvk
grftisrdnarntlylqmnslkpedtavyyctsagrrgpgtqvtvss

SCOPe Domain Coordinates for d3zlqc1:

Click to download the PDB-style file with coordinates for d3zlqc1.
(The format of our PDB-style files is described here.)

Timeline for d3zlqc1: