Lineage for d1mpal1 (1mpa L:1-112)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1511401Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1511624Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (131 PDB entries)
    Uniprot P01631 #KV2G_MOUSE Ig kappa chain V-II region 26-10; 79% sequence identity ! Uniprot P06310 # KV2F_HUMAN IG KAPPA CHAIN V-II REGION RPMI 6410 PRECURSOR ! Uniprot P03976 # KV2E_MOUSE (P03976) Ig kappa chain V-II region 17S29.1 ! Uniprot P01642 21-115 # ! KV2G_MOUSE IG KAPPA CHAIN V-II REGION 26-10
  8. 1511728Domain d1mpal1: 1mpa L:1-112 [20134]
    Other proteins in same PDB: d1mpah1, d1mpah2, d1mpal2
    part of bactericidal Fab MN12H2 against Neisseria meningitidis
    complexed with cd

Details for d1mpal1

PDB Entry: 1mpa (more details), 2.6 Å

PDB Description: bactericidal antibody against neisseria meningitidis
PDB Compounds: (L:) mn12h2 igg2a-kappa

SCOPe Domain Sequences for d1mpal1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mpal1 b.1.1.1 (L:1-112) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]}
divmtqtplslpvslgdkasiscrssqalvhsngntylhwylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvffcsqsthvprtfgggtkleik

SCOPe Domain Coordinates for d1mpal1:

Click to download the PDB-style file with coordinates for d1mpal1.
(The format of our PDB-style files is described here.)

Timeline for d1mpal1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mpal2