SCOP 1.61: Domain d1mpal1: 1mpa L:1-112

Lineage for d1mpal1 (1mpa L:1-112)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)

7. Species Bactericidal Fab MN12H2, (mouse), kappa L chain [48874] (3 PDB entries)

8. Domain d1mpal1: 1mpa L:1-112 [20134]
   Other proteins in same PDB: d1mpah2, d1mpal2

Details for d1mpal1

PDB Entry: 1mpa, 2.6 Å

PDB Description: bactericidal antibody against neisseria meningitidis

SCOP Domain Sequences for d1mpal1:

Sequence; same for both SEQRES and ATOM records:

>d1mpal1 b.1.1.1 (L:1-112) Immunoglobulin (variable domains of L and H chains) {Bactericidal Fab MN12H2, (mouse), kappa L chain}
divmtqtplslpvslgdkasiscrssqalvhsngntylhwylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvffcsqsthvprtfgggtkleik

Timeline for d1mpal1:

• d1mpal1 first appeared (with stable ids) in SCOP 1.55
  
• d1mpal1 appears in SCOP 1.59
  
• d1mpal1 appears in SCOP 1.63
  
• d1mpal1 appears in the current release, SCOPe 2.08