| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest |
Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) ![]() |
| Family c.68.1.6: glucose-1-phosphate thymidylyltransferase [53464] (4 proteins) automatically mapped to Pfam PF00483 |
| Protein automated matches [191218] (6 species) not a true protein |
| Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [193238] (11 PDB entries) |
| Domain d3zlla1: 3zll A:2-293 [201338] Other proteins in same PDB: d3zlla2, d3zllb2 automated match to d3zllb_ complexed with 4wf, cl, gol, mes |
PDB Entry: 3zll (more details), 2 Å
SCOPe Domain Sequences for d3zlla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zlla1 c.68.1.6 (A:2-293) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
krkgiilaggsgtrlhpatlaiskqllpvydkpmiyyplstlmlagireiliistpqdtp
rfqqllgdgsnwgldlqyavqpspdglaqafligesfigndlsalvlgdnlyyghdfhel
lgsasqrqtgasvfayhvldperygvvefdqggkaisleekplepksnyavtglyfydqq
vvdiardlkpsprgeleitdvnraylergqlsveimgrgyawldtgthdslleagqfiat
lenrqglkvacpeeiayrqkwidaaqleklaaplakngygqylkrlltetvy
Timeline for d3zlla1:
View in 3DDomains from other chains: (mouse over for more information) d3zllb1, d3zllb2, d3zllc_, d3zlld_ |