SCOPe 2.08: Domain d3zkxc1: 3zkx C:165-273

Lineage for d3zkxc1 (3zkx C:165-273)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)

8. Domain d3zkxc1: 3zkx C:165-273 [201337]
   Other proteins in same PDB: d3zkxa_, d3zkxb2, d3zkxc2
   automated match to d1ar1c_
   complexed with cl, dms

Details for d3zkxc1

PDB Entry: 3zkx, 2.37 Å

PDB Description: ternary bace2 xaperone complex

PDB Compounds: (C:) xa4815

SCOPe Domain Sequences for d3zkxc1:

Sequence; same for both SEQRES and ATOM records:

>d3zkxc1 b.1.1.1 (C:165-273) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvqaggslrlscaasgftfsraamrwvrraperglewvaninagdgsasyadfvk
grftasrdkagnrlylqmdnlrpndtavyyciynghrgqgtqvtvsshh

Timeline for d3zkxc1:

• d3zkxc1 first appeared in SCOPe 2.03, called d3zkxc_
  
• d3zkxc1 appears in SCOPe 2.07