| Class b: All beta proteins [48724] (178 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein automated matches [190119] (22 species) not a true protein |
| Species Llama (Lama glama) [TaxId:9844] [187485] (223 PDB entries) |
| Domain d3zkxb1: 3zkx B:165-270 [201336] Other proteins in same PDB: d3zkxa_, d3zkxb2, d3zkxc2 automated match to d3ezjb_ complexed with cl, dms |
PDB Entry: 3zkx (more details), 2.37 Å
SCOPe Domain Sequences for d3zkxb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zkxb1 b.1.1.1 (B:165-270) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvqpggslrlscaasgftfssaimtwvrqapgkgrewvstigsdgsittyadsvk
grftisrdnarntlylqmnslkpedtavyyctsagrrgpgtqvtvs
Timeline for d3zkxb1: