SCOPe 2.06: Domain d3zkxb_: 3zkx B:

Lineage for d3zkxb_ (3zkx B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (138 PDB entries)

8. Domain d3zkxb_: 3zkx B: [201336]
   Other proteins in same PDB: d3zkxa_
   automated match to d3ezjb_
   complexed with cl, dms

Details for d3zkxb_

PDB Entry: 3zkx, 2.37 Å

PDB Description: ternary bace2 xaperone complex

PDB Compounds: (B:) xa4813

SCOPe Domain Sequences for d3zkxb_:

Sequence; same for both SEQRES and ATOM records:

>d3zkxb_ b.1.1.1 (B:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlqesggglvqpggslrlscaasgftfssaimtwvrqapgkgrewvstigsdgsitty
adsvkgrftisrdnarntlylqmnslkpedtavyyctsagrrgpgtqvtvs

Timeline for d3zkxb_:

• d3zkxb_ first appeared in SCOPe 2.03
  
• d3zkxb_ appears in SCOPe 2.05
  
• d3zkxb_ is called d3zkxb1 in SCOPe 2.07
  
• d3zkxb_ appears in the current release, SCOPe 2.08, called d3zkxb1