Lineage for d3zkxb_ (3zkx B:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1289963Protein automated matches [190119] (16 species)
    not a true protein
  7. 1290216Species Llama (Lama glama) [TaxId:9844] [187485] (60 PDB entries)
  8. 1290277Domain d3zkxb_: 3zkx B: [201336]
    Other proteins in same PDB: d3zkxa_
    automated match to d3ezjb_
    complexed with cl, dms

Details for d3zkxb_

PDB Entry: 3zkx (more details), 2.37 Å

PDB Description: ternary bace2 xaperone complex
PDB Compounds: (B:) xa4813

SCOPe Domain Sequences for d3zkxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zkxb_ b.1.1.1 (B:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlqesggglvqpggslrlscaasgftfssaimtwvrqapgkgrewvstigsdgsitty
adsvkgrftisrdnarntlylqmnslkpedtavyyctsagrrgpgtqvtvs

SCOPe Domain Coordinates for d3zkxb_:

Click to download the PDB-style file with coordinates for d3zkxb_.
(The format of our PDB-style files is described here.)

Timeline for d3zkxb_: