Lineage for d3zkwc_ (3zkw C:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1389887Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 1389986Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 1390149Family c.92.2.4: TM0189-like [142789] (4 proteins)
    Part of Pfam PF01497 that include some other superfamily members
  6. 1390150Protein Enterochelin uptake protein CeuE [142792] (1 species)
  7. 1390151Species Campylobacter jejuni [TaxId:197] [142793] (3 PDB entries)
    Uniprot Q0P8Q4 44-330
  8. 1390154Domain d3zkwc_: 3zkw C: [201335]
    automated match to d3zkwa_

Details for d3zkwc_

PDB Entry: 3zkw (more details), 1.71 Å

PDB Description: Periplasmic Binding Protein CeuE apo form
PDB Compounds: (C:) enterochelin uptake periplasmic binding protein

SCOPe Domain Sequences for d3zkwc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zkwc_ c.92.2.4 (C:) Enterochelin uptake protein CeuE {Campylobacter jejuni [TaxId: 197]}
pismsdegdsflvkdslgenkipknpskvvildlgildtfdalklndkvvgvpaknlpky
lqqfknkpsvggvqqvdfeainalkpdliiisgrqskfydklkeiaptlfvgldnanfls
sfennvlsvaklyglekealekisdikneiekaksivdedkkaliiltnsnkisafgpqs
rfgiihdvlginavdenikvgthgksinsefileknpdyifvvdrnvilgnkeraqgild
nalvaktkaaqnkkiiyldpeywylasgngleslktmileiknavk

SCOPe Domain Coordinates for d3zkwc_:

Click to download the PDB-style file with coordinates for d3zkwc_.
(The format of our PDB-style files is described here.)

Timeline for d3zkwc_: