| Class b: All beta proteins [48724] (178 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein automated matches [190374] (17 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries) |
| Domain d3zknl2: 3zkn L:112-217 [201334] Other proteins in same PDB: d3zkna_, d3zknb_, d3zknd1, d3zknl1 automated match to d1dqdl2 complexed with dms, gol, so4, wzv |
PDB Entry: 3zkn (more details), 2 Å
SCOPe Domain Sequences for d3zknl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zknl2 b.1.1.2 (L:112-217) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne
Timeline for d3zknl2:
View in 3DDomains from other chains: (mouse over for more information) d3zkna_, d3zknb_, d3zknd1, d3zknd2 |