SCOPe 2.05: Domain d3zknl2: 3zkn L:112-217

Lineage for d3zknl2 (3zkn L:112-217)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (14 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (368 PDB entries)

8. Domain d3zknl2: 3zkn L:112-217 [201334]
   Other proteins in same PDB: d3zkna_, d3zknb_, d3zknd1, d3zknl1
   automated match to d1dqdl2
   complexed with dms, gol, so4, wzv

Details for d3zknl2

PDB Entry: 3zkn, 2 Å

PDB Description: bace2 fab inhibitor complex

PDB Compounds: (L:) Fab light chain

SCOPe Domain Sequences for d3zknl2:

Sequence; same for both SEQRES and ATOM records:

>d3zknl2 b.1.1.2 (L:112-217) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

Timeline for d3zknl2:

• d3zknl2 first appeared in SCOPe 2.03
  
• d3zknl2 appears in SCOPe 2.04
  
• d3zknl2 appears in SCOPe 2.06
  
• d3zknl2 appears in the current release, SCOPe 2.08