SCOPe 2.07: Domain d3zknl1: 3zkn L:1-111

Lineage for d3zknl1 (3zkn L:1-111)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (27 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (738 PDB entries)

8. Domain d3zknl1: 3zkn L:1-111 [201333]
   Other proteins in same PDB: d3zkna_, d3zknb_, d3zknd2, d3zknl2
   automated match to d1dqdl1
   complexed with dms, gol, so4, wzv

Details for d3zknl1

PDB Entry: 3zkn, 2 Å

PDB Description: bace2 fab inhibitor complex

PDB Compounds: (L:) Fab light chain

SCOPe Domain Sequences for d3zknl1:

Sequence; same for both SEQRES and ATOM records:

>d3zknl1 b.1.1.0 (L:1-111) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nivlsqspgslavslgqratiscrasksvdtyghsfihwyqqkpgqppnllihlasnles
gvparfsgrgsgtdftltidpveaddaatyycqqnnedpwtfgggtkleik

Timeline for d3zknl1:

• d3zknl1 first appeared in SCOPe 2.03
  
• d3zknl1 appears in SCOPe 2.06