Lineage for d3zkjf_ (3zkj F:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2501110Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2501111Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2501112Family d.15.1.1: Ubiquitin-related [54237] (39 protein domains)
    Pfam PF00240
  6. 2502019Protein automated matches [190118] (12 species)
    not a true protein
  7. 2502050Species Human (Homo sapiens) [TaxId:9606] [189560] (89 PDB entries)
  8. 2502138Domain d3zkjf_: 3zkj F: [201330]
    Other proteins in same PDB: d3zkjb_, d3zkje_
    complexed with cl, edo, peg

Details for d3zkjf_

PDB Entry: 3zkj (more details), 2.58 Å

PDB Description: crystal structure of ankyrin repeat and socs box-containing protein 9 (asb9) in complex with elonginb and elonginc
PDB Compounds: (F:) Transcription elongation factor B polypeptide 2

SCOPe Domain Sequences for d3zkjf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zkjf_ d.15.1.1 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgecg
ftsqtarpqapatvglafraddtfealciepfssppelpdvmkpq

SCOPe Domain Coordinates for d3zkjf_:

Click to download the PDB-style file with coordinates for d3zkjf_.
(The format of our PDB-style files is described here.)

Timeline for d3zkjf_: