Lineage for d3zkjc_ (3zkj C:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. Protein automated matches [190118] (16 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [189560] (112 PDB entries)
  8. Domain d3zkjc_: 3zkj C: [201328]
    Other proteins in same PDB: d3zkjb_, d3zkje_
    complexed with cl, edo, peg
    fragment; missing more than one-third of the common structure and/or sequence

Details for d3zkjc_

PDB Entry: 3zkj (more details), 2.58 Å

PDB Description: crystal structure of ankyrin repeat and socs box-containing protein 9 (asb9) in complex with elonginb and elonginc
PDB Compounds: (C:) Transcription elongation factor B polypeptide 2

SCOPe Domain Sequences for d3zkjc_:

Sequence, based on SEQRES records: (download)

>d3zkjc_ d.15.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgecg
ftsqtarpqapatvglafraddtfealciepfssppelpdvmkp

Sequence, based on observed residues (ATOM records): (download)

>d3zkjc_ d.15.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvflmirrhkttiftdakstvfelkrivegilkrppkddqlftsqtarpqapatvepfss
ppelpdvmkp

SCOPe Domain Coordinates for d3zkjc_ are not available.

Timeline for d3zkjc_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3zkjb_, d3zkje_, d3zkjf_