Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (195 species) not a true protein |
Species Bacillus cereus [TaxId:1396] [193273] (2 PDB entries) |
Domain d3zita_: 3zit A: [201323] automated match to d3zitb_ mutant |
PDB Entry: 3zit (more details), 1.18 Å
SCOPe Domain Sequences for d3zita_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zita_ c.47.1.0 (A:) automated matches {Bacillus cereus [TaxId: 1396]} kievyaqpdcppcvivkeflkhnnvayeefdvkkdaaarnrllydydsystptvvidgev vagfqieklqqlln
Timeline for d3zita_: