Lineage for d3ziag_ (3zia G:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2120383Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest
  4. 2120543Superfamily c.49.2: ATP synthase (F1-ATPase), gamma subunit [52943] (2 families) (S)
    contains an antiparallel coiled coil formed by N- and C-terminal extensions to the common fold
  5. 2120544Family c.49.2.1: ATP synthase (F1-ATPase), gamma subunit [52944] (1 protein)
    automatically mapped to Pfam PF00231
  6. 2120545Protein F1 ATP synthase gamma subunit [52945] (4 species)
  7. 2120546Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [310899] (6 PDB entries)
  8. 2120547Domain d3ziag_: 3zia G: [201321]
    Other proteins in same PDB: d3ziaa1, d3ziaa2, d3ziaa3, d3ziab1, d3ziab2, d3ziab3, d3ziac1, d3ziac2, d3ziac3, d3ziad1, d3ziad2, d3ziad3, d3ziae1, d3ziae2, d3ziae3, d3ziaf1, d3ziaf2, d3ziaf3, d3ziah1, d3ziah2, d3ziai_, d3ziak1, d3ziak2, d3ziak3, d3zial1, d3zial2, d3zial3, d3ziam1, d3ziam2, d3ziam3, d3zian1, d3zian2, d3zian3, d3ziao1, d3ziao2, d3ziao3, d3ziap1, d3ziap2, d3ziap3, d3ziar1, d3ziar2, d3zias_
    automated match to d2hldg_
    complexed with adp, atp, edo, mg

Details for d3ziag_

PDB Entry: 3zia (more details), 2.5 Å

PDB Description: The structure of F1-ATPase from Saccharomyces cerevisiae inhibited by its regulatory protein IF1
PDB Compounds: (G:) ATP synthase subunit gamma, mitochondrial

SCOPe Domain Sequences for d3ziag_:

Sequence, based on SEQRES records: (download)

>d3ziag_ c.49.2.1 (G:) F1 ATP synthase gamma subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
atlkevemrlksikniekitktmkivastrlskaekakisakkmdeaeqlfyknaetknl
dveatetgapkelivaitsdkglcgsihsqlakavrrhlndqpnadivtigdkikmqllr
thpnniklsingigkdaptfqesaliadkllsvmkagtypkisifyndpvsslsfepsek
pifnaktieqspsfgkfeidtdanvprdlfeytlanqmltamaqgyaaeisarrnamdna
sknagdminrysilynrtrqavitnelvdiitgass

Sequence, based on observed residues (ATOM records): (download)

>d3ziag_ c.49.2.1 (G:) F1 ATP synthase gamma subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
atlkevemrlksikniekitktmkivastrlskaekakisakkmdeaeqlfyknaetknk
elivaitsdkglcgsihsqlakavrrhlndqpnadivtigdkikmqllrthpnniklsin
gigkdaptfqesaliadkllsvmkagtypkisifyndpvsslsfepsekpifnaktieqs
psfgkfeidtdanvprdlfeytlanqmltamaqgyaaeisarrnamdnasknagdminry
silynrtrqavitnelvdiitgass

SCOPe Domain Coordinates for d3ziag_:

Click to download the PDB-style file with coordinates for d3ziag_.
(The format of our PDB-style files is described here.)

Timeline for d3ziag_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3ziaa1, d3ziaa2, d3ziaa3, d3ziab1, d3ziab2, d3ziab3, d3ziac1, d3ziac2, d3ziac3, d3ziad1, d3ziad2, d3ziad3, d3ziae1, d3ziae2, d3ziae3, d3ziaf1, d3ziaf2, d3ziaf3, d3ziah1, d3ziah2, d3ziai_, d3ziak1, d3ziak2, d3ziak3, d3zial1, d3zial2, d3zial3, d3ziam1, d3ziam2, d3ziam3, d3zian1, d3zian2, d3zian3, d3ziao1, d3ziao2, d3ziao3, d3ziap1, d3ziap2, d3ziap3, d3ziaq_, d3ziar1, d3ziar2, d3zias_