SCOP 1.55: Domain d1afvm1: 1afv M:1-112

Lineage for d1afvm1 (1afv M:1-112)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)

7. Species Fab 25.3 (mouse), kappa L chain [48825] (1 PDB entry)

8. Domain d1afvm1: 1afv M:1-112 [20132]
   Other proteins in same PDB: d1afva_, d1afvb_, d1afvh2, d1afvk2, d1afvl2, d1afvm2

Details for d1afvm1

PDB Entry: 1afv, 3.7 Å

PDB Description: hiv-1 capsid protein (p24) complex with fab25.3

SCOP Domain Sequences for d1afvm1:

Sequence; same for both SEQRES and ATOM records:

>d1afvm1 b.1.1.1 (M:1-112) Immunoglobulin (variable domains of L and H chains) {Fab 25.3 (mouse), kappa L chain}
divltqspaslavslgqratiscrasesvdnygisfmnwfqqkpgqppklliyaasnlgs
gvparfsgsgsgtdfslnihpmeeedtamyfcqqskevpltfgagtkvelkr

Timeline for d1afvm1:

• d1afvm1 appears in SCOP 1.57
  
• d1afvm1 appears in the current release, SCOPe 2.08