Lineage for d3zhwb_ (3zhw B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1715732Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1715733Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1715807Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1717797Protein automated matches [190359] (40 species)
    not a true protein
  7. 1717956Species Escherichia coli [TaxId:562] [196657] (1 PDB entry)
  8. 1717958Domain d3zhwb_: 3zhw B: [201319]
    automated match to d3zhwa_
    complexed with hem, so4

Details for d3zhwb_

PDB Entry: 3zhw (more details), 2.22 Å

PDB Description: X-ray Crystallographic Structural Characteristics of Arabidopsis Hemoglobin I and their Functional Implications
PDB Compounds: (B:) Non-symbiotic hemoglobin 1

SCOPe Domain Sequences for d3zhwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zhwb_ a.1.1.2 (B:) automated matches {Escherichia coli [TaxId: 562]}
vfteeqealvvkswsvmkknsaelglklfikifeiapttkkmfsflrdspipaeqnpklk
phamsvfvmccesavqlrktgkvtvrettlkrlgashskygvvdehfevakyalletike
avpemwspemkvawgqaydhlvaaikaemnlsn

SCOPe Domain Coordinates for d3zhwb_:

Click to download the PDB-style file with coordinates for d3zhwb_.
(The format of our PDB-style files is described here.)

Timeline for d3zhwb_: