Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.0: automated matches [191359] (1 protein) not a true family |
Protein automated matches [190417] (37 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187294] (1476 PDB entries) |
Domain d3zhpc1: 3zhp C:19-288 [201317] Other proteins in same PDB: d3zhpa_, d3zhpb_, d3zhpc2 automated match to d2w5aa_ complexed with so4 |
PDB Entry: 3zhp (more details), 2.9 Å
SCOPe Domain Sequences for d3zhpc1:
Sequence, based on SEQRES records: (download)
>d3zhpc1 d.144.1.0 (C:19-288) automated matches {Human (Homo sapiens) [TaxId: 9606]} dpeelftklekigkgsfgevfkgidnrtqkvvaikiidleeaedeiediqqeitvlsqcd spyvtkyygsylkdtklwiimeylgggsaldllepgpldetqiatilreilkgldylhse kkihrdikaanvllsehgevkladfgvagqltdtqikrntfvgtpfwmapevikqsayds kadiwslgitaielargepphselhpmkvlflipknnpptlegnyskplkefveaclnke psfrptakellkhkfilrnakktsylteli
>d3zhpc1 d.144.1.0 (C:19-288) automated matches {Human (Homo sapiens) [TaxId: 9606]} dpeelftklekigkgsfgevfkgidnrtqkvvaikiidleeaedeiediqqeitvlsqcd spyvtkyygsylkdtklwiimeylgggsaldllepgpldetqiatilreilkgldylhse kkihrdikaanvllsehgevkladfgvagqltdtrntfvgtpfwmapevikqsaydskad iwslgitaielargepphselhpmkvlflipknnpptlegnyskplkefveaclnkepsf rptakellkhkfilrnakktsylteli
Timeline for d3zhpc1: