Lineage for d3zhpb_ (3zhp B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006773Family a.118.1.15: Mo25 protein [101407] (2 protein domains)
    automatically mapped to Pfam PF08569
  6. 2006779Protein automated matches [191051] (2 species)
    not a true protein
  7. 2006780Species Human (Homo sapiens) [TaxId:9606] [188904] (4 PDB entries)
  8. 2006786Domain d3zhpb_: 3zhp B: [201316]
    Other proteins in same PDB: d3zhpc1, d3zhpc2, d3zhpd_
    automated match to d3zhpa_
    complexed with so4

Details for d3zhpb_

PDB Entry: 3zhp (more details), 2.9 Å

PDB Description: Human MST3 (STK24) in complex with MO25beta
PDB Compounds: (B:) calcium-binding protein 39-like

SCOPe Domain Sequences for d3zhpb_:

Sequence, based on SEQRES records: (download)

>d3zhpb_ a.118.1.15 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aeivkilkdnlailekqdkktdkaseevskslqamkeilcgtnekeppteavaqlaqely
ssgllvtliadlqlidfegkkdvtqifnnilrrqigtrsptveyisahphilfmllkgye
apqialrcgimlrecirheplakiilfsnqfrdffkyvelstfdiasdafatfkdlltrh
kvlvadfleqnydtifedyekllqsenyvtkrqslkllgelildrhnfaimtkyiskpen
lklmmnllrdkspniqfeafhvfkvfvasphktqpiveillknqpklieflssfqkertd
deqfadeknylikqirdlkk

Sequence, based on observed residues (ATOM records): (download)

>d3zhpb_ a.118.1.15 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aeivkilkdnlailekqdkktdkaseevskslqamkeilcgtpteavaqlaqelyssgll
vtliadlqlidfegkkdvtqifnnilrrqigtrsptveyisahphilfmllkgyeapqia
lrcgimlrecirheplakiilfsnqfrdffkyvelstfdiasdafatfkdlltrhkvlva
dfleqnydtifedyekllqsenyvtkrqslkllgelildrhnfaimtkyiskpenlklmm
nllrdkspniqfeafhvfkvfvasphktqpiveillknqpklieflssfqkertddeqfa
deknylikqirdlkk

SCOPe Domain Coordinates for d3zhpb_:

Click to download the PDB-style file with coordinates for d3zhpb_.
(The format of our PDB-style files is described here.)

Timeline for d3zhpb_: