Lineage for d3zgoc_ (3zgo C:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1360793Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 1360794Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 1361005Family c.31.1.5: Sir2 family of transcriptional regulators [63984] (8 proteins)
    silent information regulator 2; contains insertion of a rubredoxin-like zinc finger domain
  6. 1361064Protein automated matches [191258] (2 species)
    not a true protein
  7. 1361068Species Human (Homo sapiens) [TaxId:9606] [189817] (4 PDB entries)
  8. 1361073Domain d3zgoc_: 3zgo C: [201314]
    automated match to d3zgob_
    complexed with edo, eoh, p6g, pge, zn

Details for d3zgoc_

PDB Entry: 3zgo (more details), 1.63 Å

PDB Description: re-refined structure of the human sirt2 apoform
PDB Compounds: (C:) nad-dependent protein deacetylase sirtuin-2

SCOPe Domain Sequences for d3zgoc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zgoc_ c.31.1.5 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qkerlldeltlegvarymqsercrrviclvgagistsagipdfrspstglydnlekyhlp
ypeaifeisyfkkhpepffalakelypgqfkptichyfmrllkdkglllrcytqnidtle
riagleqedlveahgtfytshcvsascrheyplswmkekifsevtpkcedcqslvkpdiv
ffgespparffscmqsdflkvdlllvmgtslqvqpfasliskaplstprllinkekagqs
dpflgmimglgggmdfdskkayrdvawlgecdqgclalaellgwkkeledlvrrehasid
aqs

SCOPe Domain Coordinates for d3zgoc_:

Click to download the PDB-style file with coordinates for d3zgoc_.
(The format of our PDB-style files is described here.)

Timeline for d3zgoc_: