Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) binds cofactor molecules in the opposite direction than classical Rossmann fold |
Family c.31.1.5: Sir2 family of transcriptional regulators [63984] (8 proteins) silent information regulator 2; contains insertion of a rubredoxin-like zinc finger domain |
Protein automated matches [191258] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189817] (4 PDB entries) |
Domain d3zgoc_: 3zgo C: [201314] automated match to d3zgob_ complexed with edo, eoh, p6g, pge, zn |
PDB Entry: 3zgo (more details), 1.63 Å
SCOPe Domain Sequences for d3zgoc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zgoc_ c.31.1.5 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} qkerlldeltlegvarymqsercrrviclvgagistsagipdfrspstglydnlekyhlp ypeaifeisyfkkhpepffalakelypgqfkptichyfmrllkdkglllrcytqnidtle riagleqedlveahgtfytshcvsascrheyplswmkekifsevtpkcedcqslvkpdiv ffgespparffscmqsdflkvdlllvmgtslqvqpfasliskaplstprllinkekagqs dpflgmimglgggmdfdskkayrdvawlgecdqgclalaellgwkkeledlvrrehasid aqs
Timeline for d3zgoc_: