Lineage for d3zfea_ (3zfe A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2821496Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2821778Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2822534Family b.121.4.0: automated matches [191569] (1 protein)
    not a true family
  6. 2822535Protein automated matches [190988] (51 species)
    not a true protein
  7. 2822651Species Human enterovirus 71 [TaxId:39054] [226325] (11 PDB entries)
  8. 2822656Domain d3zfea_: 3zfe A: [201312]
    Other proteins in same PDB: d3zfec_
    automated match to d2plv1_
    complexed with cl, na, sph

Details for d3zfea_

PDB Entry: 3zfe (more details), 2.7 Å

PDB Description: Human enterovirus 71 in complex with capsid binding inhibitor WIN51711
PDB Compounds: (A:) vp1

SCOPe Domain Sequences for d3zfea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zfea_ b.121.4.0 (A:) automated matches {Human enterovirus 71 [TaxId: 39054]}
drvadviessigdsvsraltqalpaptgqntqvsshrldtgevpalqaaeigassntsde
smietrcvlnshstaettldsffsraglvgeidlplegttnpngyanwdiditgyaqmrr
kvelftymrfdaeftfvactptgqvvpqllqymfvppgapkpesreslawqtatnpsvfv
kltdppaqvsvpfmspasayqwfydgyptfgehkqekdleygacpnnmmgtfsvrnvgss
kskyplvvriymrmkhvrawiprpmrnqnylfkanpnyagnsikptgtsrtaittlg

SCOPe Domain Coordinates for d3zfea_:

Click to download the PDB-style file with coordinates for d3zfea_.
(The format of our PDB-style files is described here.)

Timeline for d3zfea_: