SCOP 1.73: Domain d1afvh1: 1afv H:1-120

Lineage for d1afvh1 (1afv H:1-120)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (148 PDB entries)

8. Domain d1afvh1: 1afv H:1-120 [20131]
   Other proteins in same PDB: d1afva_, d1afvb_, d1afvh2, d1afvk2, d1afvl1, d1afvl2, d1afvm1, d1afvm2

Details for d1afvh1

PDB Entry: 1afv, 3.7 Å

PDB Description: hiv-1 capsid protein (p24) complex with fab25.3

PDB Compounds: (H:) antibody fab25.3 fragment (heavy chain)

SCOP Domain Sequences for d1afvh1:

Sequence; same for both SEQRES and ATOM records:

>d1afvh1 b.1.1.1 (H:1-120) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
qvqlqqpgsvlvrpgasvklsckasgytftsswihwakqrpgqglewigeihpnsgntny
nekfkgkatltvdtssstayvdlssltsedsavyycarwrygspyyfdywgqgttltvss

Timeline for d1afvh1:

• d1afvh1 first appeared (with stable ids) in SCOP 1.55
  
• d1afvh1 appears in SCOP 1.71
  
• d1afvh1 appears in SCOP 1.75
  
• d1afvh1 appears in the current release, SCOPe 2.08