| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
| Domain d3zdxf1: 3zdx F:1-107 [201306] Other proteins in same PDB: d3zdxa_, d3zdxc_, d3zdxe_, d3zdxf2, d3zdxh_, d3zdxl2 automated match to d1dqdl1 complexed with ca, cl, gol, mn, nag, so4 |
PDB Entry: 3zdx (more details), 2.45 Å
SCOPe Domain Sequences for d3zdxf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zdxf1 b.1.1.0 (F:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dilmtqspssmsvslgdtvsitchasqgissnigwlqqkpgksfmgliyygtnlvdgvps
rfsgsgsgadysltissldsedfadyycvqyaqlpytfgggtkleik
Timeline for d3zdxf1: