SCOPe 2.08: Domain d3zdxf1: 3zdx F:1-107

Lineage for d3zdxf1 (3zdx F:1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d3zdxf1: 3zdx F:1-107 [201306]
   Other proteins in same PDB: d3zdxa_, d3zdxc_, d3zdxe_, d3zdxf2, d3zdxh_, d3zdxl2
   automated match to d1dqdl1
   complexed with ca, cl, gol, mn, nag, so4

Details for d3zdxf1

PDB Entry: 3zdx, 2.45 Å

PDB Description: integrin alphaiib beta3 headpiece and rgd peptide complex

PDB Compounds: (F:) 10e5 fab, light chain

SCOPe Domain Sequences for d3zdxf1:

Sequence; same for both SEQRES and ATOM records:

>d3zdxf1 b.1.1.0 (F:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dilmtqspssmsvslgdtvsitchasqgissnigwlqqkpgksfmgliyygtnlvdgvps
rfsgsgsgadysltissldsedfadyycvqyaqlpytfgggtkleik

Timeline for d3zdxf1:

• d3zdxf1 first appeared in SCOPe 2.03
  
• d3zdxf1 appears in SCOPe 2.07