Lineage for d1afvl1 (1afv L:1-112)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219420Species Fab 25.3 (mouse), kappa L chain [48825] (1 PDB entry)
    against HIV-1 capsid protein (p24)
  8. 219423Domain d1afvl1: 1afv L:1-112 [20130]
    Other proteins in same PDB: d1afva_, d1afvb_, d1afvh2, d1afvk2, d1afvl2, d1afvm2

Details for d1afvl1

PDB Entry: 1afv (more details), 3.7 Å

PDB Description: hiv-1 capsid protein (p24) complex with fab25.3

SCOP Domain Sequences for d1afvl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1afvl1 b.1.1.1 (L:1-112) Immunoglobulin (variable domains of L and H chains) {Fab 25.3 (mouse), kappa L chain}
divltqspaslavslgqratiscrasesvdnygisfmnwfqqkpgqppklliyaasnlgs
gvparfsgsgsgtdfslnihpmeeedtamyfcqqskevpltfgagtkvelkr

SCOP Domain Coordinates for d1afvl1:

Click to download the PDB-style file with coordinates for d1afvl1.
(The format of our PDB-style files is described here.)

Timeline for d1afvl1: