Lineage for d3zdgl_ (3zdg L:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2073791Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2073792Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2073793Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 protein domains)
    automatically mapped to Pfam PF02931
  6. 2073794Protein Acetylcholine binding protein (ACHBP) [63714] (1 species)
  7. 2073795Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [63715] (8 PDB entries)
  8. 2073813Domain d3zdgl_: 3zdg L: [201296]
    Other proteins in same PDB: d3zdgd_, d3zdge_, d3zdgf_, d3zdgg_
    automated match to d1uv6a_
    complexed with 1pe, nag, peg, so4, xrx

Details for d3zdgl_

PDB Entry: 3zdg (more details), 2.48 Å

PDB Description: Crystal Structure of Ls-AChBP complexed with carbamoylcholine analogue 3-(dimethylamino)butyl dimethylcarbamate (DMABC)
PDB Compounds: (L:) acetylcholine binding protein

SCOPe Domain Sequences for d3zdgl_:

Sequence, based on SEQRES records: (download)

>d3zdgl_ b.96.1.1 (L:) Acetylcholine binding protein (ACHBP) {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
nsvtysccpeayedvevslnfrkk

Sequence, based on observed residues (ATOM records): (download)

>d3zdgl_ b.96.1.1 (L:) Acetylcholine binding protein (ACHBP) {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdptdseyfsqysrfeildvtqkknsvty
sccpeayedvevslnfrkk

SCOPe Domain Coordinates for d3zdgl_:

Click to download the PDB-style file with coordinates for d3zdgl_.
(The format of our PDB-style files is described here.)

Timeline for d3zdgl_: