Lineage for d3zdgh_ (3zdg H:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2084600Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2084601Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2084602Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins)
    automatically mapped to Pfam PF02931
  6. 2084603Protein Acetylcholine binding protein (ACHBP) [63714] (1 species)
  7. 2084604Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [63715] (8 PDB entries)
  8. 2084618Domain d3zdgh_: 3zdg H: [201292]
    Other proteins in same PDB: d3zdgd_, d3zdge_, d3zdgf_, d3zdgg_
    automated match to d1uv6a_
    complexed with 1pe, nag, peg, so4, xrx

Details for d3zdgh_

PDB Entry: 3zdg (more details), 2.48 Å

PDB Description: crystal structure of ls-achbp complexed with carbamoylcholine analogue 3-(dimethylamino)butyl dimethylcarbamate (dmabc)
PDB Compounds: (H:) acetylcholine binding protein

SCOPe Domain Sequences for d3zdgh_:

Sequence, based on SEQRES records: (download)

>d3zdgh_ b.96.1.1 (H:) Acetylcholine binding protein (ACHBP) {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
nsvtysccpeayedvevslnfrkkg

Sequence, based on observed residues (ATOM records): (download)

>d3zdgh_ b.96.1.1 (H:) Acetylcholine binding protein (ACHBP) {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdptdseyfsqysrfeildvtqkknsvty
sccpeayedvevslnfrkkg

SCOPe Domain Coordinates for d3zdgh_:

Click to download the PDB-style file with coordinates for d3zdgh_.
(The format of our PDB-style files is described here.)

Timeline for d3zdgh_: