Lineage for d1mimh1 (1mim H:1-115)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (181 PDB entries)
    Uniprot P01756 1-117 # 78% sequense identity; HV12_MOUSE Ig heavy chain V region MOPC 104E ! SQ NA # humanized antibody ! Uniprot P01750 # HV06_MOUSE Ig heavy chain V region 102 precursor ! Uniprot P01750 20-116 # ! HV06_MOUSE Ig heavy chain V region 102 precursor
  8. Domain d1mimh1: 1mim H:1-115 [20129]
    Other proteins in same PDB: d1mimh2, d1miml1, d1miml2
    part of CD25-binding humanized Fab CHI621
    part of Fab HyHEL-5

Details for d1mimh1

PDB Entry: 1mim (more details), 2.6 Å

PDB Description: igg fab fragment (cd25-binding)
PDB Compounds: (H:) chimeric sdz chi621

SCOPe Domain Sequences for d1mimh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mimh1 b.1.1.1 (H:1-115) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
qlqqsgtvlarpgasvkmsckasgysftrywmhwikqrpgqglewigaiypgnsdtsynq
kfegkakltavtsastaymelsslthedsavyycsrdygyyfdfwgqgttltvss

SCOPe Domain Coordinates for d1mimh1 are not available.

Timeline for d1mimh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mimh2
View in 3D
Domains from other chains:
(mouse over for more information)
d1miml1, d1miml2