| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.1: ARM repeat [48371] (28 families) ![]() |
| Family a.118.1.17: BC3264-like [109965] (3 proteins) Pfam PF06352; DUF1061 this is a repeat family; one repeat unit is 1t06 A:120-163 found in domain |
| Protein automated matches [197126] (1 species) not a true protein |
| Species Bacillus cereus [TaxId:1396] [197127] (1 PDB entry) |
| Domain d3zboa1: 3zbo A:1-235 [201284] Other proteins in same PDB: d3zboa2 automated match to d3zbob_ complexed with cl |
PDB Entry: 3zbo (more details), 1.58 Å
SCOPe Domain Sequences for d3zboa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zboa1 a.118.1.17 (A:1-235) automated matches {Bacillus cereus [TaxId: 1396]}
mdfktvmqelealgkertkkiyisngahepvfgvatgamkpiakkiklnqelaeelyatg
nydamyfagiiadpkamsesdfdrwidgayfymlsdyvvavtlsesniaqdvadkwiasg
delkmsagwscycwllgnrkdnafseskisdmlemvkdtihhspertksamnnflntvai
syvplhekaveiakevgivevkrdnkkssllnasesiqkeldrgrlgfkrkyvrc
Timeline for d3zboa1: