Lineage for d3zboa1 (3zbo A:1-235)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2725422Superfamily a.118.1: ARM repeat [48371] (28 families) (S)
  5. 2725948Family a.118.1.17: BC3264-like [109965] (3 proteins)
    Pfam PF06352; DUF1061
    this is a repeat family; one repeat unit is 1t06 A:120-163 found in domain
  6. 2725957Protein automated matches [197126] (1 species)
    not a true protein
  7. 2725958Species Bacillus cereus [TaxId:1396] [197127] (1 PDB entry)
  8. 2725959Domain d3zboa1: 3zbo A:1-235 [201284]
    Other proteins in same PDB: d3zboa2
    automated match to d3zbob_
    complexed with cl

Details for d3zboa1

PDB Entry: 3zbo (more details), 1.58 Å

PDB Description: a new family of proteins related to the heat-like repeat dna glycosylases with affinity for branched dna structures
PDB Compounds: (A:) alkf

SCOPe Domain Sequences for d3zboa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zboa1 a.118.1.17 (A:1-235) automated matches {Bacillus cereus [TaxId: 1396]}
mdfktvmqelealgkertkkiyisngahepvfgvatgamkpiakkiklnqelaeelyatg
nydamyfagiiadpkamsesdfdrwidgayfymlsdyvvavtlsesniaqdvadkwiasg
delkmsagwscycwllgnrkdnafseskisdmlemvkdtihhspertksamnnflntvai
syvplhekaveiakevgivevkrdnkkssllnasesiqkeldrgrlgfkrkyvrc

SCOPe Domain Coordinates for d3zboa1:

Click to download the PDB-style file with coordinates for d3zboa1.
(The format of our PDB-style files is described here.)

Timeline for d3zboa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3zboa2
View in 3D
Domains from other chains:
(mouse over for more information)
d3zbob_