SCOPe 2.07: Domain d3zboa1: 3zbo A:1-235

Lineage for d3zboa1 (3zbo A:1-235)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.1: ARM repeat [48371] (27 families)

5. Family a.118.1.17: BC3264-like [109965] (3 protein domains)
   Pfam PF06352; DUF1061

6. Protein automated matches [197126] (1 species)
   not a true protein

7. Species Bacillus cereus [TaxId:1396] [197127] (1 PDB entry)

8. Domain d3zboa1: 3zbo A:1-235 [201284]
   Other proteins in same PDB: d3zboa2
   automated match to d3zbob_
   complexed with cl

Details for d3zboa1

PDB Entry: 3zbo, 1.58 Å

PDB Description: A new family of proteins related to the HEAT-like repeat DNA glycosylases with affinity for branched DNA structures

PDB Compounds: (A:) alkf

SCOPe Domain Sequences for d3zboa1:

Sequence; same for both SEQRES and ATOM records:

>d3zboa1 a.118.1.17 (A:1-235) automated matches {Bacillus cereus [TaxId: 1396]}
mdfktvmqelealgkertkkiyisngahepvfgvatgamkpiakkiklnqelaeelyatg
nydamyfagiiadpkamsesdfdrwidgayfymlsdyvvavtlsesniaqdvadkwiasg
delkmsagwscycwllgnrkdnafseskisdmlemvkdtihhspertksamnnflntvai
syvplhekaveiakevgivevkrdnkkssllnasesiqkeldrgrlgfkrkyvrc

Timeline for d3zboa1:

• d3zboa1 first appeared in SCOPe 2.03, called d3zboa_
  
• d3zboa1 appears in SCOPe 2.06