SCOPe 2.03: Domain d3w69b_: 3w69 B:

Lineage for d3w69b_ (3w69 B:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
   core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
   duplication: consists of two structural repeats

4. Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families)
   binds to the transactivation domain of human p53

5. Family a.42.1.1: SWIB/MDM2 domain [47593] (4 proteins)
   Pfam PF02201

6. Protein MDM2 [47594] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47596] (36 PDB entries)

8. Domain d3w69b_: 3w69 B: [201283]
   automated match to d3vzvb_
   complexed with ltz, so4

Details for d3w69b_

PDB Entry: 3w69, 1.9 Å

PDB Description: Crystal structure of human mdm2 with a dihydroimidazothiazole inhibitor

PDB Compounds: (B:) E3 ubiquitin-protein ligase Mdm2

SCOPe Domain Sequences for d3w69b_:

Sequence; same for both SEQRES and ATOM records:

>d3w69b_ a.42.1.1 (B:) MDM2 {Human (Homo sapiens) [TaxId: 9606]}
etlvrpkpellkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycsndllgd
lfgvpsfsvkehrkiytmiyrnlvv

Timeline for d3w69b_:

• d3w69b_ is new in SCOPe 2.03-stable
  
• d3w69b_ appears in SCOPe 2.04
  
• d3w69b_ appears in the current release, SCOPe 2.08