Lineage for d3w5ug2 (3w5u G:155-314)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2859730Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 2859731Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 2859901Family c.25.1.0: automated matches [227163] (1 protein)
    not a true family
  6. 2859902Protein automated matches [226871] (19 species)
    not a true protein
  7. 2859941Species Maize (Zea mays) [TaxId:4577] [226538] (17 PDB entries)
  8. 2859962Domain d3w5ug2: 3w5u G:155-314 [201281]
    Other proteins in same PDB: d3w5ua1, d3w5ub_, d3w5uc1, d3w5ud_, d3w5ue1, d3w5uf_, d3w5ug1, d3w5uh_
    automated match to d1frna2
    complexed with fad, fes

Details for d3w5ug2

PDB Entry: 3w5u (more details), 2.7 Å

PDB Description: Cross-linked complex between Ferredoxin and Ferredoxin-NADP+ reductase
PDB Compounds: (G:) ferredoxin

SCOPe Domain Sequences for d3w5ug2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3w5ug2 c.25.1.0 (G:155-314) automated matches {Maize (Zea mays) [TaxId: 4577]}
mlmpkdpnatiimlatgtgiapfrsflwkmffekhddykfnglgwlflgvptsssllyke
efgkmkerapenfrvdyavsreqtnaagermyiqtrmaeykeelwellkkdntyvymcgl
kgmekgiddimvslaekdgidwfdykkqlkrgdqwnvevy

SCOPe Domain Coordinates for d3w5ug2:

Click to download the PDB-style file with coordinates for d3w5ug2.
(The format of our PDB-style files is described here.)

Timeline for d3w5ug2: