SCOPe 2.07: Domain d3w5ug1: 3w5u G:19-154

Lineage for d3w5ug1 (3w5u G:19-154)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families)

5. Family b.43.4.0: automated matches [227162] (1 protein)
   not a true family

6. Protein automated matches [226870] (22 species)
   not a true protein

7. Species Maize (Zea mays) [TaxId:4577] [226539] (17 PDB entries)

8. Domain d3w5ug1: 3w5u G:19-154 [201280]
   Other proteins in same PDB: d3w5ua2, d3w5ub_, d3w5uc2, d3w5ud_, d3w5ue2, d3w5uf_, d3w5ug2, d3w5uh_
   automated match to d1frna1
   complexed with fad, fes

Details for d3w5ug1

PDB Entry: 3w5u, 2.7 Å

PDB Description: Cross-linked complex between Ferredoxin and Ferredoxin-NADP+ reductase

PDB Compounds: (G:) ferredoxin

SCOPe Domain Sequences for d3w5ug1:

Sequence; same for both SEQRES and ATOM records:

>d3w5ug1 b.43.4.0 (G:19-154) automated matches {Maize (Zea mays) [TaxId: 4577]}
cskkqeegvvtnlykpkepyvgrcllntkitgddapgetwhmvfstegkipyregqsigv
iadgvdkngkphkvrlysiassaigdfgdsktvslcvkrliytndageivkgvcsnflcd
lqpgdnvqitgpvgke

Timeline for d3w5ug1:

• d3w5ug1 first appeared in SCOPe 2.03
  
• d3w5ug1 appears in SCOPe 2.06
  
• d3w5ug1 appears in the current release, SCOPe 2.08