Lineage for d1miml1 (1mim L:1-105)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 546420Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)
  6. 547289Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 547704Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88528] (19 PDB entries)
  8. 547711Domain d1miml1: 1mim L:1-105 [20128]
    Other proteins in same PDB: d1mimh1, d1mimh2, d1miml2
    part of CD25-binding humanized Fab CHI621

Details for d1miml1

PDB Entry: 1mim (more details), 2.6 Å

PDB Description: igg fab fragment (cd25-binding)

SCOP Domain Sequences for d1miml1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1miml1 b.1.1.1 (L:1-105) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2}
qivstqspaimsaspgekvtmtcsasssrsymqwyqqkpgtspkrwiydtsklasgvpar
fsgsgsgtsysltissmeaedaatyychqrssytfgggtkleikr

SCOP Domain Coordinates for d1miml1:

Click to download the PDB-style file with coordinates for d1miml1.
(The format of our PDB-style files is described here.)

Timeline for d1miml1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1miml2