Lineage for d1miml1 (1mim L:1-105)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 157354Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 157410Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)
  7. 158046Species Fab CHI621 (mouse), kappa L chain [48824] (1 PDB entry)
  8. 158048Domain d1miml1: 1mim L:1-105 [20128]
    Other proteins in same PDB: d1mimh2, d1miml2

Details for d1miml1

PDB Entry: 1mim (more details), 2.6 Å

PDB Description: igg fab fragment (cd25-binding)

SCOP Domain Sequences for d1miml1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1miml1 b.1.1.1 (L:1-105) Immunoglobulin (variable domains of L and H chains) {Fab CHI621 (mouse), kappa L chain}
qivstqspaimsaspgekvtmtcsasssrsymqwyqqkpgtspkrwiydtsklasgvpar
fsgsgsgtsysltissmeaedaatyychqrssytfgggtkleikr

SCOP Domain Coordinates for d1miml1:

Click to download the PDB-style file with coordinates for d1miml1.
(The format of our PDB-style files is described here.)

Timeline for d1miml1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1miml2