Lineage for d3w5ud_ (3w5u D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2540890Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2540891Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins)
  6. 2540892Protein 2Fe-2S ferredoxin [54294] (19 species)
  7. 2540928Species Maize (Zea mays) [TaxId:4577] [54305] (5 PDB entries)
  8. 2540933Domain d3w5ud_: 3w5u D: [201276]
    Other proteins in same PDB: d3w5ua1, d3w5ua2, d3w5uc1, d3w5uc2, d3w5ue1, d3w5ue2, d3w5ug1, d3w5ug2
    automated match to d3w5ub_
    complexed with fad, fes

Details for d3w5ud_

PDB Entry: 3w5u (more details), 2.7 Å

PDB Description: Cross-linked complex between Ferredoxin and Ferredoxin-NADP+ reductase
PDB Compounds: (D:) Ferredoxin-1, chloroplastic

SCOPe Domain Sequences for d3w5ud_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3w5ud_ d.15.4.1 (D:) 2Fe-2S ferredoxin {Maize (Zea mays) [TaxId: 4577]}
atynvklitpegevelqvpddvyildqaeedgidlpyscragscsscagkvvsgsvdqcd
qsylddgqiadgwvltchayptsdvviethkeeel

SCOPe Domain Coordinates for d3w5ud_:

Click to download the PDB-style file with coordinates for d3w5ud_.
(The format of our PDB-style files is described here.)

Timeline for d3w5ud_: