SCOPe 2.03: Domain d3w5uc2: 3w5u C:155-314

Lineage for d3w5uc2 (3w5u C:155-314)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
   3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families)
   binds NADP differently than classical Rossmann-fold
   N-terminal FAD-linked domain contains (6,10) barrel

5. Family c.25.1.0: automated matches [227163] (1 protein)
   not a true family

6. Protein automated matches [226871] (12 species)
   not a true protein

7. Species Maize (Zea mays) [TaxId:4577] [226538] (5 PDB entries)

8. Domain d3w5uc2: 3w5u C:155-314 [201275]
   Other proteins in same PDB: d3w5ua1, d3w5ub_, d3w5uc1, d3w5ud_, d3w5ue1, d3w5uf_, d3w5ug1, d3w5uh_
   automated match to d1frna2
   complexed with fad, fes

Details for d3w5uc2

PDB Entry: 3w5u, 2.7 Å

PDB Description: Cross-linked complex between Ferredoxin and Ferredoxin-NADP+ reductase

PDB Compounds: (C:) ferredoxin

SCOPe Domain Sequences for d3w5uc2:

Sequence; same for both SEQRES and ATOM records:

>d3w5uc2 c.25.1.0 (C:155-314) automated matches {Maize (Zea mays) [TaxId: 4577]}
mlmpkdpnatiimlatgtgiapfrsflwkmffekhddykfnglgwlflgvptsssllyke
efgkmkerapenfrvdyavsreqtnaagermyiqtrmaeykeelwellkkdntyvymcgl
kgmekgiddimvslaekdgidwfdykkqlkrgdqwnvevy

Timeline for d3w5uc2:

• d3w5uc2 is new in SCOPe 2.03-stable
  
• d3w5uc2 appears in SCOPe 2.04
  
• d3w5uc2 appears in the current release, SCOPe 2.08