| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily) 3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) ![]() binds NADP differently than classical Rossmann-fold N-terminal FAD-linked domain contains (6,10) barrel |
| Family c.25.1.0: automated matches [227163] (1 protein) not a true family |
| Protein automated matches [226871] (19 species) not a true protein |
| Species Maize (Zea mays) [TaxId:4577] [226538] (17 PDB entries) |
| Domain d3w5ua2: 3w5u A:155-314 [201273] Other proteins in same PDB: d3w5ua1, d3w5ub_, d3w5uc1, d3w5ud_, d3w5ue1, d3w5uf_, d3w5ug1, d3w5uh_ automated match to d1frna2 complexed with fad, fes |
PDB Entry: 3w5u (more details), 2.7 Å
SCOPe Domain Sequences for d3w5ua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3w5ua2 c.25.1.0 (A:155-314) automated matches {Maize (Zea mays) [TaxId: 4577]}
mlmpkdpnatiimlatgtgiapfrsflwkmffekhddykfnglgwlflgvptsssllyke
efgkmkerapenfrvdyavsreqtnaagermyiqtrmaeykeelwellkkdntyvymcgl
kgmekgiddimvslaekdgidwfdykkqlkrgdqwnvevy
Timeline for d3w5ua2: